PDB entry 5rub

View 5rub on RCSB PDB site
Description: crystallographic refinement and structure of ribulose-1,5-bisphosphate carboxylase from rhodospirillum rubrum at 1.7 angstroms resolution
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1990-05-29, released 1991-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (114)
    Domains in SCOPe 2.07: d5ruba1, d5ruba2
  • Chain 'B':
    Compound: rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)
    Species: Rhodospirillum rubrum [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04718
      • conflict (114)
    Domains in SCOPe 2.07: d5rubb1, d5rubb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5rubA (A:)
    tmitnspdrwgysaphrtsresppmdqssryvnlalkeedliaggehvlcayimkpkagy
    gyvataahfaaesstgtnvevcttddftrgvdalvyevdeareltkiaypvalfdrnitd
    gkamiasfltltmgnnqgmgdveyakmhdfyvpeayralfdgpsvnisalwkvlgrpevd
    gglvvgtiikpklglrpkpfaeachafwlggdfikndepqgnqpfaplrdtialvadamr
    raqdetgeaklfsanitaddpfeiiargeyvletfgenashvallvdgyvagaaaittar
    rrfpdnflhyhraghgavtspqskrgytafvhckmarlqgasgihtgtmgfgkmegessd
    raiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlgnanviltaggga
    fghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgdadqiypgwrkalg
    vedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5rubA (A:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtrgvdalvy
    evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
    ralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikn
    depqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfg
    enashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckma
    rlqgasgihtgtssdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffe
    nlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfp
    gdadqiypgwrkalgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5rubB (B:)
    tmitnspdrwgysaphrtsresppmdqssryvnlalkeedliaggehvlcayimkpkagy
    gyvataahfaaesstgtnvevcttddftrgvdalvyevdeareltkiaypvalfdrnitd
    gkamiasfltltmgnnqgmgdveyakmhdfyvpeayralfdgpsvnisalwkvlgrpevd
    gglvvgtiikpklglrpkpfaeachafwlggdfikndepqgnqpfaplrdtialvadamr
    raqdetgeaklfsanitaddpfeiiargeyvletfgenashvallvdgyvagaaaittar
    rrfpdnflhyhraghgavtspqskrgytafvhckmarlqgasgihtgtmgfgkmegessd
    raiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlgnanviltaggga
    fghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgdadqiypgwrkalg
    vedtrsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5rubB (B:)
    dqssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtrgvdalvy
    evdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpeay
    ralfdgpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikn
    depqgnqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfg
    enashvallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckma
    rlqgasgihtgdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlg
    nanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgda
    dqiypgwrkalgv