PDB entry 5qj1

View 5qj1 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE HEPATITIS C VIRUS GENOTYPE 2A STRAIN JFH1 L30S NS5B RNA-DEPENDENT RNA POLYMERASE IN COMPLEX WITH 6-(ethylamino)-2-(4-fluorophenyl)-5-(3-{[1-(5-fluoropyrimidin-2-yl)cyclopropyl]carbamoyl}-4-methoxyphenyl)-N-methyl-1-benzofuran-3-carboxamide
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: RDRP STRUCTURE (FINGERS, PALM, THUMB DOMAINS), ACETYLATION, APOPTOSIS, ATP-BINDING, CAPSID PROTEIN, CELL MEMBRANE, CYTOPLASM, DISULFIDE BOND, ENDOPLASMIC RETICULUM, ENVELOPE PROTEIN, FUSION PROTEIN, GLYCOPROTEIN, HELICASE, HOST-VIRUS INTERACTION, HYDROLASE, INTERFERON ANTIVIRAL SYSTEM EVASION, LIPID DROPLET, LIPOPROTEIN, MEMBRANE, METAL- BINDING, MITOCHONDRION, MULTIFUNCTIONAL ENZYME, NUCLEOTIDE- BINDING, NUCLEOTIDYLTRANSFERASE, NUCLEUS, ONCOGENE, PALMITATE, PHOSPHOPROTEIN, PROTEASE, RIBONUCLEOPROTEIN, RNA REPLICATION, RNA-BINDING, RNA-DIRECTED RNA POLYMERASE, SECRETED, SERINE PROTEASE, SH3-BINDING, THIOL PROTEASE, TRANSCRIPTION, TRANSCRIPTION REGULATION, TRANSFERASE, TRANSMEMBRANE, UBL CONJUGATION, VIRAL NUCLEOPROTEIN, VIRION, ZINC, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2018-08-13, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-dependent RNA polymerase
    Species: Hepacivirus C [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot R9THT8 (1-End)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d5qj1a_
  • Heterogens: J6J, SO4, GOL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qj1A (A:)
    msmsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqv
    ldahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhi
    ksvwkdlledpqtpipttimaknevfcvdpakggkkparlivypdlgvrvcekmalydit
    qklpqavmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesi
    yqacslpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvka
    laackaagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeyd
    lelitscssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyapti
    wvrmvlmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtysh
    heltrvasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltpl
    pearlldlsswftvgagggdifhsvsrarprsll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qj1A (A:)
    smsyswtgalitpcspeeeklpinplsnsslryhnkvycttsksasqrakkvtfdrtqvl
    dahydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
    svwkdlledpqtpipttimaknevfcvdgkkparlivypdlgvrvcekmalyditqklpq
    avmgasygfqyspaqrveyllkawaekkdpmgfsydtrcfdstvterdirteesiyqacs
    lpeeartaihslterlyvggpmfnskgqtcgyrrcrasgvlttsmgntitcyvkalaack
    aagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydlelit
    scssnvsvalgprgrrryyltrdpttplaraawetvrhspinswlgniiqyaptiwvrmv
    lmthffsilmvqdtldqnlnfemygsvysvnpldlpaiierlhgldafsmhtyshheltr
    vasalrklgapplrvwksraravraslisrggkaavcgrylfnwavktklkltplpearl
    ldl