PDB entry 5qim

View 5qim on RCSB PDB site
Description: tgf-beta receptor type 1 kinase domain (t204d) in complex with n-{4-[3-(5-methoxypyridin-2-yl)-1h-pyrrolo[3,2-b] pyridin-2-yl]pyridin-2-yl}acetamide
Class: transferase/transferase inhibitor
Keywords: alk5, sb431542, kinase domain, transferase-transferase inhibitor complex, transferase
Deposited on 2018-08-05, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR1, ALK5, SKR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36897 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5qima1, d5qima2
  • Heterogens: J2Y, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qimA (A:)
    ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
    nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
    meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
    ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
    veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsq
    qegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qimA (A:)
    ggtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhe
    nilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlh
    meivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkr
    ymapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdps
    veemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsq
    qegi