PDB entry 5qfb

View 5qfb on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal structure of PTP1B in complex with compound_PKOOA000283c
Class: hydrolase
Keywords: PanDDA, SGC - Diamond I04-1 fragment screening, protein tyrosine phosphatase, PTP, protein tyrosine phosphatase 1B, PTP1B, enzyme, allostery, multiconformer, HYDROLASE
Deposited on 2018-08-30, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (0-End)
      • engineered mutation (31)
      • engineered mutation (91)
    Domains in SCOPe 2.07: d5qfba_
  • Heterogens: JND, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qfbA (A:)
    memekefeqidksgswaaiyqdirheasdfpsrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntvghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qfbA (A:)
    memekefeqidksgswaaiyqdirheasdfpsrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntvghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim