PDB entry 5pna

View 5pna on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of JMJD2D after initial refinement with no ligand modelled (structure 204)
Class: oxidoreductase
Keywords: PanDDA, SGC - Diamond I04-1 fragment screening, Jmj domain, epigenetics, OXIDOREDUCTASE
Deposited on 2017-02-07, released 2017-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4D, JHDM3D, JMJD2D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5pnaa_
  • Heterogens: ZN, NI, MG, OGA, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5pnaA (A:)
    mhhhhhhssgvdlgtenlyfqsmetmkskancaqnpncnimifhptkeefndfdkyiaym
    esqgahraglakiippkewkaretydniseiliatplqqvasgragvftqyhkkkkamtv
    geyrhlanskkyqtpphqnfedlerkywknriynspiygadisgslfdentkqwnlghlg
    tiqdllekecgvviegvntpylyfgmwkttfawhtedmdlysinylhlgepktwyvvppe
    hgqrlerlarelfpgssrgcgaflrhkvalisptvlkengipfnritqeagefmvtfpyg
    yhagfnhgfncaeainfatprwidygkmasqcscgearvtfsmdafvrilqperydlwkr
    gqdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5pnaA (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrgqd