PDB entry 5pgz

View 5pgz on RCSB PDB site
Description: crystal structure of murine 11beta- hydroxysteroiddehydrogenase complexed with 2-[(5r,7s)-6-hydroxy-2-phenyladamantan-2-yl]-1-(3-hydroxyazetidin-1-yl)ethan-1-one (bms-816336)
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: 11B-HSD1, SDR, DEHYDROGENASE, HYDROXYSTEROID, INHIBITOR, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBI complex, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2017-02-06, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Mus musculus [TaxId:10090]
    Gene: Hsd11b1, Hsd11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5pgza_
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Mus musculus [TaxId:10090]
    Gene: Hsd11b1, Hsd11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5pgzb_
  • Heterogens: NAP, 8KG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5pgzA (A:)
    mhhhhhhneefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvs
    rclelgaasahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsv
    rrvmevnflsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffst
    irtelyitkvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksev
    yydkspltpillgnpgrkimeffslryynkdmfvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5pgzA (A:)
    eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
    sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
    lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
    kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
    pillgnpgrkimeffslryynkdmf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5pgzB (B:)
    mhhhhhhneefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvs
    rclelgaasahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsv
    rrvmevnflsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffst
    irtelyitkvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksev
    yydkspltpillgnpgrkimeffslryynkdmfvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5pgzB (B:)
    eefrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaa
    sahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnf
    lsyvvmstaalpmlkqsngsiavisslagkmtqpmiapysaskfaldgffstirtelyit
    kvnvsitlcvlglidtetamkeisgiinaqaspkeecaleiikgtalrksevyydksplt
    pillgnpgrkimeffslryynkdmf