PDB entry 5pdx

View 5pdx on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement with no ligand modelled (structure 90)
Class: DNA binding protein
Keywords: PanDDA, SGC - Diamond I04-1 fragment screening, bromodomain, epigenetics, DNA BINDING PROTEIN
Deposited on 2017-02-03, released 2017-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (23-End)
      • expression tag (21-22)
    Domains in SCOPe 2.08: d5pdxa1, d5pdxa2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5pdxA (A:)
    mhhhhhhssgvdlgtenlyfqsmsvkkpkrddskdlalcsmiltemethedawpfllpvn
    lklvpgykkvikkpmdfstireklssgqypnletfaldvrlvfdncetfneddsdigrag
    hnmrkyfekkwtdtfkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5pdxA (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk