PDB entry 5owk

View 5owk on RCSB PDB site
Description: Crystal structure of CREBBP bromodomain complexed with DSPB2A002
Class: transcription
Keywords: CREBBP bromodomain, Inhibitor, TRANSCRIPTION
Deposited on 2017-09-01, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5owka_
  • Heterogens: 7MX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5owkA (A:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5owkA (A:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl