PDB entry 5owj

View 5owj on RCSB PDB site
Description: The dynamic dimer structure of the chaperone Trigger Factor (conformer 2)
Class: chaperone
Keywords: Chaperone, dimer
Deposited on 2017-09-01, released 2017-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trigger Factor
    Species: Escherichia coli [TaxId:562]
    Gene: tig, b0436, JW0426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5owja1, d5owja2, d5owja3
  • Chain 'B':
    Compound: Trigger Factor
    Species: Escherichia coli [TaxId:562]
    Gene: tig, b0436, JW0426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5owjb1, d5owjb2, d5owjb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5owjA (A:)
    mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
    svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
    eaievekpivevtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefegg
    kasdfvlamgqgrmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkv
    eerelpeltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandi
    dvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnel
    kadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtek
    ettfnelmnqqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5owjB (B:)
    mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
    svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
    eaievekpivevtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefegg
    kasdfvlamgqgrmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkv
    eerelpeltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandi
    dvpaalidseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnel
    kadeervkglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtek
    ettfnelmnqqa