PDB entry 5owc

View 5owc on RCSB PDB site
Description: Indole-2 carboxamides as selective secreted phospholipase A2 type X (sPLA2-X) inhibitors
Class: lipid binding protein
Keywords: Inhibitor, secreted, phospholipase, LIPID BINDING PROTEIN
Deposited on 2017-08-31, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-05, with a file datestamp of 2021-04-30.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: group 10 secretory phospholipase a2
  Species: Homo sapiens [TaxId:9606]
  Gene: PLA2G10
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15496 (0-121)
  Domains in SCOPe 2.08: d5owca_
• Chain 'B':
  Compound: group 10 secretory phospholipase a2
  Species: Homo sapiens [TaxId:9606]
  Gene: PLA2G10
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15496 (0-121)
  Domains in SCOPe 2.08: d5owcb_
• Heterogens: AYZ, CA, DMS, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5owcA (A:)
  gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
  kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
  kc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5owcB (B:)
  gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
  kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
  kc