PDB entry 5our

View 5our on RCSB PDB site
Description: X-ray structure uridine phosphorylase from Vibrio cholerae in complex with 2,2'-anhydrouridine at 1.34 A.
Class: transferase
Keywords: TRANSFERASE, Rossmann Fold
Deposited on 2017-08-24, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, BFX32_04820, BTY66_05555, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oura_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, BFX32_04820, BTY66_05555, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ourb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, BFX32_04820, BTY66_05555, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ourc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, BFX32_04820, BTY66_05555, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ourd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, BFX32_04820, BTY66_05555, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oure_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: Vibrio cholerae [TaxId:666]
    Gene: udp, udp_1, BFX32_04820, BTY66_05555, DN30_1909, EN12_05055, ERS013138_02408, ERS013140_00580, ERS013186_00327, ERS013199_00063, ERS013201_00032, ERS013202_00369, ERS013206_00377
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ourf_
  • Heterogens: NA, BJE, CL, EDO, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ourA (A:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ourA (A:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ourB (B:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ourB (B:)
    tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv
    vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh
    fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg
    smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi
    kvvveaarkmlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ourC (C:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ourC (C:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkmlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ourD (D:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ourD (D:)
    tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv
    vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh
    fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg
    smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi
    kvvveaarkmlk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ourE (E:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ourE (E:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkmlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ourF (F:)
    mtktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqs
    vvvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgasl
    hfapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfq
    gsmkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketears
    ikvvveaarkmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ourF (F:)
    ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv
    vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf
    apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs
    mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik
    vvveaarkmlk