PDB entry 5ou7

View 5ou7 on RCSB PDB site
Description: Crystal structure of the Glycoprotein VI loop truncation mutant PAVS-PAPYKN
Class: blood clotting
Keywords: Platelet, glycoprotein, GPVI, collagen-binding, platelet activation, BLOOD CLOTTING
Deposited on 2017-08-23, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Platelet glycoprotein VI
    Species: Homo sapiens [TaxId:9606]
    Gene: gp6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ou7a1, d5ou7a2
  • Chain 'B':
    Compound: Platelet glycoprotein VI
    Species: Homo sapiens [TaxId:9606]
    Gene: gp6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ou7b1, d5ou7b2
  • Chain 'C':
    Compound: Platelet glycoprotein VI
    Species: Homo sapiens [TaxId:9606]
    Gene: gp6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCN6 (Start-177)
      • expression tag (178-180)
    Domains in SCOPe 2.07: d5ou7c1, d5ou7c2, d5ou7c3
  • Chain 'D':
    Compound: Platelet glycoprotein VI
    Species: Homo sapiens [TaxId:9606]
    Gene: gp6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCN6 (Start-177)
      • expression tag (178-180)
    Domains in SCOPe 2.07: d5ou7d1, d5ou7d2, d5ou7d3
  • Heterogens: CL, PO4, PG6, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ou7A (A:)
    gsqsgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipam
    krslagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgsggdvtlqcqtrygfdq
    falykegdperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvtgtsaa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ou7A (A:)
    sgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamkrs
    lagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgsggdvtlqcqtrygfdqfal
    ykegdperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvtg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ou7B (B:)
    gsqsgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipam
    krslagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgsggdvtlqcqtrygfdq
    falykegdperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvtgtsaa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ou7B (B:)
    sgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamkrs
    lagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgsggdvtlqcqtrygfdqfal
    ykegdperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvtg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ou7C (C:)
    gsqsgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipam
    krslagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgsggdvtlqcqtrygfdq
    falykegdperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvtgtsaa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ou7C (C:)
    sgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamkrs
    lagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgsggdvtlqcqtrygfdqfal
    ykegdperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvtgtsaaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ou7D (D:)
    gsqsgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipam
    krslagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgsggdvtlqcqtrygfdq
    falykegdperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvtgtsaa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ou7D (D:)
    sgplpkpslqalpsslvplekpvtlrcqgppgvdlyrleklsssryqdqavlfipamkrs
    lagryrcsyqngslwslpsdqlelvatgvfakpslsaqpgsggdvtlqcqtrygfdqfal
    ykegdperwyrasfpiitvtaahsgtyrcysfssrdpylwsapsdplelvvtgtsaaa