PDB entry 5otn

View 5otn on RCSB PDB site
Description: Crystal structure of zebrafish MTH1 in complex with O6-methyl-dGMP
Class: hydrolase
Keywords: MTH1, Inhibitor, Complex, Hydrolase, NUDIX, Methylated nucleotide, O6-methyl-dGMP, zebrafish
Deposited on 2017-08-22, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: N/A
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nudix (Nucleoside diphosphate linked moiety X)-type motif 1
    Species: Danio rerio [TaxId:7955]
    Gene: NUDT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5otna_
  • Heterogens: 6OG, GOL, CA, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5otnA (A:)
    gshmftsklltlvlvvqpgrvllgmkkrgfgagkwngfggkvqtgetieqaarrellees
    gltvdtlhkignikfefigetelmdvhifradnyegepaesdemrpqwfdidkipfsqmw
    addilwfplmlqkkrflgyfkfqghdvivehkldevedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otnA (A:)
    mftsklltlvlvvqpgrvllgmkkrgfgagkwngfggkvqtgetieqaarrelleesglt
    vdtlhkignikfefigetelmdvhifradnyegepaesdemrpqwfdidkipfsqmwadd
    ilwfplmlqkkrflgyfkfqghdvivehkldevedl