PDB entry 5otm

View 5otm on RCSB PDB site
Description: Crystal structure of human MTH1 in complex with O6-methyl-dGMP
Class: hydrolase
Keywords: MTH1, Inhibitor, Complex, Hydrolase, NUDIX, Methylated nucleotide, O6-methyl-dGMP
Deposited on 2017-08-22, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (3-158)
      • expression tag (2)
    Domains in SCOPe 2.07: d5otma1, d5otma2
  • Chain 'B':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (3-158)
      • expression tag (2)
    Domains in SCOPe 2.07: d5otmb1, d5otmb2
  • Heterogens: 6OG, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5otmA (A:)
    gshmgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqees
    gltvdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmw
    pddsywfplllqkkkfhgyfkfqgqdtildytlrevdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otmA (A:)
    hmgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgl
    tvdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpd
    dsywfplllqkkkfhgyfkfqgqdtildytlrevdtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5otmB (B:)
    gshmgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqees
    gltvdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmw
    pddsywfplllqkkkfhgyfkfqgqdtildytlrevdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otmB (B:)
    hmgasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgl
    tvdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpd
    dsywfplllqkkkfhgyfkfqgqdtildytlrevdtv