PDB entry 5otj

View 5otj on RCSB PDB site
Description: Monomeric polcalcin (Phl p 7) in complex with two identical allergen-specific antibodies
Class: immune system
Keywords: Fab, allergen, antibody, IgE, polcalcin, IMMUNE SYSTEM
Deposited on 2017-08-22, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 102.1F10 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OTJ (0-End)
    Domains in SCOPe 2.07: d5otja1, d5otja2
  • Chain 'B':
    Compound: 102.1F10 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OTJ (0-End)
  • Chain 'C':
    Compound: Polcalcin Phl p 7
    Species: PHLEUM PRATENSE [TaxId:15957]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Polcalcin Phl p 7
    Species: PHLEUM PRATENSE [TaxId:15957]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 102.1F10 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OTJ (0-End)
  • Chain 'L':
    Compound: 102.1F10 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OTJ (0-End)
    Domains in SCOPe 2.07: d5otjl1, d5otjl2
  • Heterogens: EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5otjA (A:)
    esaltqppsvsgapgqrvsisctggssnfgagydvhwyqqlpatapklliygnnnrpsgv
    pdrfsgsksgtsaslaitglqaedegdyfcqsfdtslsgwifgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otjA (A:)
    esaltqppsvsgapgqrvsisctggssnfgagydvhwyqqlpatapklliygnnnrpsgv
    pdrfsgsksgtsaslaitglqaedegdyfcqsfdtslsgwifgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5otjL (L:)
    esaltqppsvsgapgqrvsisctggssnfgagydvhwyqqlpatapklliygnnnrpsgv
    pdrfsgsksgtsaslaitglqaedegdyfcqsfdtslsgwifgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otjL (L:)
    esaltqppsvsgapgqrvsisctggssnfgagydvhwyqqlpatapklliygnnnrpsgv
    pdrfsgsksgtsaslaitglqaedegdyfcqsfdtslsgwifgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt