PDB entry 5os9

View 5os9 on RCSB PDB site
Description: Structure of the B3 DNA-Binding Domain of NGA1
Class: DNA binding protein
Keywords: Transcription factor B3 DNA binding domain, DNA BINDING PROTEIN
Deposited on 2017-08-17, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B3 domain-containing transcription factor NGA1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NGA1, At2g46870, F19D11.25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5os9a_
  • Chain 'B':
    Compound: B3 domain-containing transcription factor NGA1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NGA1, At2g46870, F19D11.25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5os9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5os9A (A:)
    madrehmfdkvvtpsdvgklnrlvipkqhaerffpldsssnekglllnfedltgkswrfr
    ysywnssqsyvmtkgwsrfvkdkkldagdivsfqrcvgdsgrdsrlfidwrrrpkvghhh
    hhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5os9A (A:)
    adrehmfdkvvtpsdvgklnrlvipkqhaerffpldsssnekglllnfedltgkswrfry
    sywnssqsyvmtkgwsrfvkdkkldagdivsfqrcvgdsgrdsrlfidwrrrpkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5os9B (B:)
    madrehmfdkvvtpsdvgklnrlvipkqhaerffpldsssnekglllnfedltgkswrfr
    ysywnssqsyvmtkgwsrfvkdkkldagdivsfqrcvgdsgrdsrlfidwrrrpkvghhh
    hhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5os9B (B:)
    adrehmfdkvvtpsdvgklnrlvipkqhaerffpldsssnekglllnfedltgkswrfry
    sywnssqsyvmtkgwsrfvkdkkldagdivsfqrcvgdsgrdsrlfidwrrrp