PDB entry 5oq4

View 5oq4 on RCSB PDB site
Description: PQR309 - a Potent, Brain-Penetrant, Orally Bioavailable, pan-Class I PI3K/mTOR Inhibitor as Clinical Candidate in Oncology
Class: transferase
Keywords: PI3K, 3-kinase, lipid kinase, kinase, inhibitor, PQR309, NCB5, TRANSFERASE
Deposited on 2017-08-10, released 2017-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736
      • conflict (316)
    Domains in SCOPe 2.07: d5oq4a1, d5oq4a2, d5oq4a3, d5oq4a4
  • Heterogens: A3W, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oq4A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvrllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oq4A (A:)
    eesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvts
    kplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkqdfvlrvcgrdey
    lvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkecdrkfrvkirgidipvlnt
    dltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycrl
    lyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldnhpira
    empnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiva
    ktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvq
    avkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg
    tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnslpesfrvp
    ydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilq
    ilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgfkdevl
    nhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfgh
    ilgervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmt
    gmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv