PDB entry 5opf

View 5opf on RCSB PDB site
Description: Structure of LPMO10B from from Micromonospora aurantiaca
Class: carbohydrate
Keywords: Lytic polysaccharide monooxygenase (LPMO), CARBOHYDRATE
Deposited on 2017-08-09, released 2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitin-binding domain 3 protein
    Species: Micromonospora aurantiaca ATCC 27029 [TaxId:644283]
    Gene: Micau_1630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5opfa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5opfA (A:)
    hgsvvdpasrsyscwqrwggdfqnpamatqdpmcwqawqadpnamwnwnglfregvagnh
    qgaipdgqlcsggrtqsgrynaldtvgawktvpvtnnfrvkffdqashgadyirvyvtkq
    gynaltsplrwsdlelvgqigntpasqwtrevdgvsiqipanapgrtgrhvvytiwqash
    ldqsyylcsdvdfg