PDB entry 5opa

View 5opa on RCSB PDB site
Description: The crystal structure of P450 CYP121 in complex with lead compound 7b
Class: oxidoreductase
Keywords: Cytochrome P450 Inhibitor complex, oxidoreductase
Deposited on 2017-08-09, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mycocyclosin synthase
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: cyp121, MT2336
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5opaa_
  • Heterogens: A2W, SO4, HEM, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5opaA (A:)
    mtatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrf
    smketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansl
    ldnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaaki
    nwdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgs
    flttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvr
    kgelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigie
    allkkmpgvdlavpidqlvwrtrfqrriperlpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5opaA (A:)
    tvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsmk
    etaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslldn
    litegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwd
    rdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsflt
    talisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkge
    lvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieall
    kkmpgvdlavpidqlvwrtrfqrriperlpvlw