PDB entry 5oo6

View 5oo6 on RCSB PDB site
Description: Complex of human nuclear cap-binding complex with ARS2 C-terminal peptide
Class: nuclear protein
Keywords: Complex nuclear cap-binding complex m7GTP C-terminal peptide from ARS2, nuclear protein
Deposited on 2017-08-06, released 2017-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP1, CBP80, NCBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09161 (Start-771)
      • conflict (460)
  • Chain 'B':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP2, CBP20, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oo6b_
  • Chain 'C':
    Compound: Serrate RNA effector molecule homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SRRT, ARS2, ASR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP1, CBP80, NCBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09161 (Start-771)
      • conflict (460)
  • Chain 'E':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP2, CBP20, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oo6e_
  • Chain 'F':
    Compound: Serrate RNA effector molecule homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SRRT, ARS2, ASR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP1, CBP80, NCBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09161 (Start-771)
      • conflict (460)
  • Chain 'H':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP2, CBP20, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oo6h_
  • Chain 'I':
    Compound: Serrate RNA effector molecule homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SRRT, ARS2, ASR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP1, CBP80, NCBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09161 (Start-771)
      • conflict (460)
  • Chain 'K':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP2, CBP20, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oo6k_
  • Chain 'L':
    Compound: Serrate RNA effector molecule homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SRRT, ARS2, ASR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP1, CBP80, NCBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09161 (Start-771)
      • conflict (460)
  • Chain 'N':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP2, CBP20, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oo6n_
  • Chain 'O':
    Compound: Serrate RNA effector molecule homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SRRT, ARS2, ASR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP1, CBP80, NCBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09161 (Start-771)
      • conflict (460)
  • Chain 'Q':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP2, CBP20, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oo6q_
  • Chain 'R':
    Compound: Serrate RNA effector molecule homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SRRT, ARS2, ASR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP1, CBP80, NCBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09161 (Start-771)
      • conflict (460)
  • Chain 'T':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP2, CBP20, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oo6t_
  • Chain 'U':
    Compound: Serrate RNA effector molecule homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SRRT, ARS2, ASR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Nuclear cap-binding protein subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP1, CBP80, NCBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09161 (Start-771)
      • conflict (460)
  • Chain 'W':
    Compound: Nuclear cap-binding protein subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCBP2, CBP20, PIG55
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oo6w_
  • Chain 'X':
    Compound: Serrate RNA effector molecule homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SRRT, ARS2, ASR2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MGT

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oo6B (B:)
    gamsggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiye
    lfsksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdag
    fkegrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo6B (B:)
    gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
    gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
    qygrgrsggqvrdeyrqdydagrggygk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5oo6E (E:)
    gamsggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiye
    lfsksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdag
    fkegrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo6E (E:)
    gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
    gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
    qygrgrsggqvrdeyrqdydagrggygk
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5oo6H (H:)
    gamsggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiye
    lfsksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdag
    fkegrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo6H (H:)
    gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
    gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
    qygrgrsggqvrdeyrqdydagrggygk
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5oo6K (K:)
    gamsggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiye
    lfsksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdag
    fkegrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo6K (K:)
    gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
    gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
    qygrgrsggqvrdeyrqdydagrggygk
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5oo6N (N:)
    gamsggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiye
    lfsksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdag
    fkegrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo6N (N:)
    gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
    gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
    qygrgrsggqvrdeyrqdydagrggygk
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5oo6Q (Q:)
    gamsggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiye
    lfsksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdag
    fkegrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo6Q (Q:)
    gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
    gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
    qygrgrsggqvrdeyrqdydagrggygk
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5oo6T (T:)
    gamsggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiye
    lfsksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdag
    fkegrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo6T (T:)
    gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
    gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
    qygrgrsggqvrdeyrqdydagrggygk
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5oo6W (W:)
    gamsggllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiye
    lfsksgdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdag
    fkegrqygrgrsggqvrdeyrqdydagrggygklaqnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo6W (W:)
    gllkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsks
    gdikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegr
    qygrgrsggqvrdeyrqdydagrggygk
    

  • Chain 'X':
    No sequence available.