PDB entry 5oo1

View 5oo1 on RCSB PDB site
Description: Cdk2(F80C, C177A) covalent adduct with C37 at F80C
Class: transferase
Keywords: Covalent inhibitor, Cysteine modification, Kinase, Allosteric inhibitor, TRANSFERASE
Deposited on 2017-08-04, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (Start-302)
      • engineered mutation (84)
      • engineered mutation (181)
    Domains in SCOPe 2.07: d5oo1a_
  • Heterogens: 9Z2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oo1A (A:)
    gplgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
    kelnhpnivklldvihtenklylvceflhqdlkkfmdasaltgiplpliksylfqllqgl
    afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
    gakyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
    ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    lrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo1A (A:)
    fqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnhpni
    vklldvihtenklylvceflhqdlkkfmdasaltgiplpliksylfqllqglafchshrv
    lhrdlkpqnllintegaikladfvtlwyrapeillgakyystavdiwslgcifaemvtrr
    alfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarqdfskvvppldedgr
    sllsqmlhydpnkrisakaalahpffqdvtkpvphlrl