PDB entry 5oo0

View 5oo0 on RCSB PDB site
Description: Cdk2(WT) covalent adduct with D28 at C177
Class: transferase
Keywords: Covalent inhibitor, Cysteine modification, Kinase, Allosteric inhibitor, TRANSFERASE
Deposited on 2017-08-04, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oo0a_
  • Heterogens: 9YZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oo0A (A:)
    gplgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
    kelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgl
    afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
    gckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
    ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    lrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oo0A (A:)
    enfqkvekigegtygvvykarnkltgevvalkkirvpstaireisllkelnhpnivklld
    vihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvlhrdl
    kpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystavdiws
    lgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarqdf
    skvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl