PDB entry 5onc

View 5onc on RCSB PDB site
Description: Catabolism of the Cholesterol Side Chain in Mycobacterium tuberculosis is Controlled by a Redox-Sensitive Thiol Switch
Class: biosynthetic protein
Keywords: Oxidative Stress, Cholesterol Metabolism, Lipid degradation, Steroid metabolism, Mycobacterium tuberculosis, BIOSYNTHETIC PROTEIN
Deposited on 2017-08-03, released 2017-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroid 3-ketoacyl-CoA thiolase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: fadA5, LH57_19345, Rv3546
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6XHI4 (8-398)
      • expression tag (7)
    Domains in SCOPe 2.06: d5onca1, d5onca2, d5onca3
  • Chain 'B':
    Compound: Steroid 3-ketoacyl-CoA thiolase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: fadA5, LH57_19345, Rv3546
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5oncb1, d5oncb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oncA (A:)
    hhhhhhgsmgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdv
    eqviggcvtqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagai
    dvgiacgieamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvf
    glesqrraqrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelk
    pvleggihtagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpv
    qstakvlekagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgct
    gsrlittalhelertdqslalitmcaggalstgtiieri
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oncA (A:)
    smgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggc
    vtnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgieamsr
    vdlpnqfeaaeriakrrgitredvdvfglesqrraqrawaegrfdreispiqapvldeqn
    qptgerrlvfrdqglrettmaglgelkpvleggihtagtssqisdgaaavlwmdeavara
    hgltprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlsw
    arvhepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstg
    tiieri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oncB (B:)
    hhhhhhgsmgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdv
    eqviggcvtqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagai
    dvgiacgieamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvf
    glesqrraqrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelk
    pvleggihtagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpv
    qstakvlekagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgct
    gsrlittalhelertdqslalitmcaggalstgtiieri
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oncB (B:)
    mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
    tqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgieams
    pnqfeaaeriakrrgitredvdvfglesqrraqrawaegrfdreispiqapvldeqnqpt
    lvfrdqglrettmaglgelkpvleggihtagtssqisdgaaavlwmdeavarahgltpra
    rivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswarvhepd
    mdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgtiieri