PDB entry 5omz

View 5omz on RCSB PDB site
Description: Solution structure of domain III (DIII)of Zika virus Envelope protein
Class: viral protein
Keywords: ZIKA virus Envelope protein domain, VIRAL PROTEIN, ZIKV
Deposited on 2017-08-02, released 2017-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Zika virus (strain Mr 766) [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5omza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5omzA (A:)
    mdklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltp
    vgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigk