PDB entry 5ome

View 5ome on RCSB PDB site
Description: The cryofrozen atomic resolution X-ray crystal structure of the reduced form (Fe2+) perdeuterated Pyrococcus furiosus Rubredoxin in D2O (100K, 0.75 Angstrom resolution)
Class: electron transport
Keywords: Perdeuterated rubredoxin, pyrococcus furiosus, atomic resolution, cryofrozen, reduced, iron, ELECTRON TRANSPORT
Deposited on 2017-07-31, released 2018-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 0.75 Å
R-factor: N/A
AEROSPACI score: 1.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: RUB, PF1282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5omea_
  • Heterogens: FE, NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5omeA (A:)
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled