SCOPe 2.08: Structural Classification of Proteins

PDB entry 5olc

View 5olc on RCSB PDB site
Description: Crystal structure of the 3,6-anhydro-D-galactonate cycloisomerase from Zobellia galactanivorans
Class: isomerase
Keywords: cycloisomerase, enolase superfamily, 3, 6-anhydro-D-galactonate, carrageenan, ISOMERASE
Deposited on 2017-07-27, released 2017-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Galactonate dehydratase
Species: Zobellia galactanivorans [TaxId:63186]
Gene: dgoD, zobellia_3156
Database cross-references and differences (RAF-indexed):
- Uniprot G0L7B8 (9-End)
  - expression tag (8)
Domains in SCOPe 2.08: d5olca1, d5olca2, d5olca3
Chain 'B':
Compound: Galactonate dehydratase
Species: Zobellia galactanivorans [TaxId:63186]
Gene: dgoD, zobellia_3156
Database cross-references and differences (RAF-indexed):
- Uniprot G0L7B8 (9-End)
  - expression tag (8)
Domains in SCOPe 2.08: d5olcb1, d5olcb2, d5olcb3
Chain 'C':
Compound: Galactonate dehydratase
Species: Zobellia galactanivorans [TaxId:63186]
Gene: dgoD, zobellia_3156
Database cross-references and differences (RAF-indexed):
- Uniprot G0L7B8 (9-End)
  - expression tag (8)
Domains in SCOPe 2.08: d5olcc1, d5olcc2, d5olcc3
Chain 'D':
Compound: Galactonate dehydratase
Species: Zobellia galactanivorans [TaxId:63186]
Gene: dgoD, zobellia_3156
Database cross-references and differences (RAF-indexed):
- Uniprot G0L7B8 (9-End)
  - expression tag (8)
Domains in SCOPe 2.08: d5olcd1, d5olcd2, d5olcd3
Chain 'E':
Compound: Galactonate dehydratase
Species: Zobellia galactanivorans [TaxId:63186]
Gene: dgoD, zobellia_3156
Database cross-references and differences (RAF-indexed):
- Uniprot G0L7B8 (9-End)
  - expression tag (8)
Domains in SCOPe 2.08: d5olce1, d5olce2, d5olce3
Chain 'F':
Compound: Galactonate dehydratase
Species: Zobellia galactanivorans [TaxId:63186]
Gene: dgoD, zobellia_3156
Database cross-references and differences (RAF-indexed):
- Uniprot G0L7B8 (9-End)
  - expression tag (8)
Domains in SCOPe 2.08: d5olcf1, d5olcf2, d5olcf3
Chain 'G':
Compound: Galactonate dehydratase
Species: Zobellia galactanivorans [TaxId:63186]
Gene: dgoD, zobellia_3156
Database cross-references and differences (RAF-indexed):
- Uniprot G0L7B8 (9-End)
  - expression tag (8)
Domains in SCOPe 2.08: d5olcg1, d5olcg2, d5olcg3
Chain 'H':
Compound: Galactonate dehydratase
Species: Zobellia galactanivorans [TaxId:63186]
Gene: dgoD, zobellia_3156
Database cross-references and differences (RAF-indexed):
- Uniprot G0L7B8 (9-End)
  - expression tag (8)
Domains in SCOPe 2.08: d5olch1, d5olch2, d5olch3
Heterogens: MG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5olcA (A:)
mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
levpctpglgvdvdmdklehyldkeihkdgatkirs