PDB entry 5okk

View 5okk on RCSB PDB site
Description: Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose
Class: hydrolase
Keywords: 6-phospho-beta-galactosidase, 6-phospho-beta-galactose, GH1, glycoside hydrolase, Gan1D, HYDROLASE
Deposited on 2017-07-25, released 2017-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5okka_
  • Chain 'B':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5okkb_
  • Heterogens: BGP, GOL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5okkA (A:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okkA (A:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
    rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
    wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5okkB (B:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okkB (B:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
    rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
    wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael