PDB entry 5oka

View 5oka on RCSB PDB site
Description: Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus
Class: hydrolase
Keywords: 6-phospho-beta-galactosidase, Geobacillus stearothermophilus, Glycoside Hydrolase, GH1 family, HYDROLASE
Deposited on 2017-07-25, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QF82 (Start-484)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d5okaa_
  • Chain 'B':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QF82 (Start-484)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d5okab_
  • Chain 'C':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QF82 (Start-484)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d5okac_
  • Chain 'D':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8QF82 (Start-484)
      • engineered mutation (176)
    Domains in SCOPe 2.07: d5okad_
  • Heterogens: GOL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5okaA (A:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okaA (A:)
    rhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhr
    yqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtly
    hwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlgl
    hppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlaf
    enaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqt
    ttvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpili
    tenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlng
    yqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5okaB (B:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okaB (B:)
    rhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhr
    yqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtly
    hwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlgl
    hppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlaf
    enaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqt
    ttvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpili
    tenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlng
    yqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5okaC (C:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okaC (C:)
    rhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhr
    yqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtly
    hwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlgl
    hppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlaf
    enaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqt
    ttvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpili
    tenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlng
    yqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5okaD (D:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okaD (D:)
    rhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhr
    yqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtly
    hwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlgl
    hppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlaf
    enaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqt
    ttvehnppdgvgtssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpili
    tenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlng
    yqkrygfvyvnrddesekdlrrikkksfywyqrvietngael