PDB entry 5ok9

View 5ok9 on RCSB PDB site
Description: CH1 chimera of human 14-3-3 sigma with the HSPB6 phosphopeptide in a conformation with swapped phosphopeptides
Class: signaling protein
Keywords: 14-3-3 proteins, Protein chimera, phosphopeptide-binding, SIGNALING PROTEIN
Deposited on 2017-07-25, released 2017-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma,Heat shock protein beta-6
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPB6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (3-233)
      • expression tag (1-2)
      • linker (234-237)
    • Uniprot O14558 (238-245)
    Domains in SCOPe 2.06: d5ok9a1, d5ok9a2
  • Chain 'B':
    Compound: 14-3-3 protein sigma,Heat shock protein beta-6
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPB6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (3-233)
      • expression tag (0-2)
      • engineered mutation (78-79)
      • linker (234-237)
    • Uniprot O14558 (238-245)
    Domains in SCOPe 2.06: d5ok9b1, d5ok9b2
  • Chain 'E':
    Compound: 14-3-3 protein sigma,Heat shock protein beta-6
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPB6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (3-233)
      • expression tag (1-2)
      • engineered mutation (79)
      • linker (234-237)
    • Uniprot O14558 (238-245)
    Domains in SCOPe 2.06: d5ok9e1, d5ok9e2
  • Chain 'F':
    Compound: 14-3-3 protein sigma,Heat shock protein beta-6
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPB6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (3-233)
      • expression tag (1-2)
      • engineered mutation (78-79)
      • linker (234-237)
    • Uniprot O14558 (238-End)
    Domains in SCOPe 2.06: d5ok9f1, d5ok9f2
  • Heterogens: SEP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ok9A (A:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslr
    rasapl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ok9A (A:)
    phmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraa
    wrvlssieqksngpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkg
    dyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeian
    speeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslrrasapl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ok9B (B:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslr
    rasapl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ok9B (B:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneaagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfyl
    kmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhy
    eianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslrrasa
    pl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ok9E (E:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslr
    rasapl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ok9E (E:)
    phmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraa
    wrvlssieqksneagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkm
    kgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyei
    anspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslrrasapl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ok9F (F:)
    gphmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqra
    awrvlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesr
    vfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfs
    vfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslr
    rasapl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ok9F (F:)
    phmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraa
    wrvlssieqksnaagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkm
    kgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyei
    anspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsgslrrasap