PDB entry 5ok2

View 5ok2 on RCSB PDB site
Description: Structure of the D10N mutant of beta-phosphoglucomutase from Lactococcus lactis inhibited with glucose 6-phosphate and tetrafluoroaluminate to 1.1A resolution.
Class: isomerase
Keywords: phosphoglucomutase, transition-state analogue, general acid-base catalysis, ISOMERASE
Deposited on 2017-07-25, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: pgmB, LL0429, L0001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-217)
      • engineered mutation (9)
      • engineered mutation (124)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d5ok2a_
  • Heterogens: ALF, EDO, NA, MG, BG6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ok2A (A:)
    mfkavlfdlngvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlq