PDB entry 5ojz

View 5ojz on RCSB PDB site
Description: D10N variant of beta-phosphoglucomutase from Lactococcus lactis inhibited by a beryllium triflouride phosphoenzyme analogue to 1.3A resolution.
Class: isomerase
Keywords: phosphoglucomutase, phosphoenzyme analogue, isomerase
Deposited on 2017-07-25, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: pgmB, LL0429, L0001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-219)
      • engineered mutation (9)
      • engineered mutation (124)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d5ojza_
  • Heterogens: MG, BEF, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ojzA (A:)
    mfkavlfdlngvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkq