PDB entry 5ojk

View 5ojk on RCSB PDB site
Description: Crystal structure of the human neuroligin 1 cholinesterase domain containing spliced sequence B (SSB) (NL1(-A+B))
Class: cell adhesion
Keywords: neuroligin-neurexin, synaptic organizer protein, spliced sequence B, CELL ADHESION
Deposited on 2017-07-21, released 2017-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuroligin-1,Neuroligin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: NLGN1, KIAA1070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ojka_
  • Chain 'B':
    Compound: Neuroligin-1,Neuroligin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: NLGN1, KIAA1070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ojkb_
  • Heterogens: NAG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ojkA (A:)
    etgqklddvdplvatnfgkirgikkelnneilgpviqflgvpyaapptgerrfqppepps
    pwsdirnatqfapvcpqniidgrlpevmlpvwftnnldvvssyvqdqsedclylniyvpt
    eddirdsggpkpvmvyihggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgd
    qaakgnyglldliqalrwtsenigffggdplritvfgsgaggscvnlltlshysegnrws
    nstkglfqraiaqsgtalsswavsfqpakyarmlatkvgcnvsdtvelveclqkkpykel
    vdqdiqparyhiafgpvidgdvipddpqilmeqgeflnydimlgvnqgeglkfvenivds
    ddgisasdfdfavsnfvdnlygypegkdvlretikfmytdwadrhnpetrrktllalftd
    hqwvapavatadlhsnfgsptyfyafyhhcqtdqvpawadaahgdevpyvlgipmigpte
    lfpcnfskndvmlsavvmtywtnfaktgdpnqpvpqdtkfihtkpnrfeevawtrysqkd
    qlylhiglkprvkehyrankvnlwlelvphlhnlndrtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ojkA (A:)
    dplvatnfgkirgikkelnneilgpviqflgvpyaapptgerrfqppeppspwsdirnat
    qfapvcpqniidrlpevmlpvwftnnldvvssyvqdqsedclylniyvptggpkpvmvyi
    hggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgdqaakgnyglldliqalr
    wtsenigffggdplritvfgsgaggscvnlltlshysegnrwsnstkglfqraiaqsgta
    lsswavsfqpakyarmlatkvgcnvsdtvelveclqkkpykelvdqdiqparyhiafgpv
    idgdvipddpqilmeqgeflnydimlgvnqgeglkfvenivdsddgisasdfdfavsnfv
    dnlygypgkdvlretikfmytdwadrhnpetrrktllalftdhqwvapavatadlhsnfg
    sptyfyafyhhcqtdqvpawadaahgdevpyvlgipmigptelfpcnfskndvmlsavvm
    tywtnfaktgdpnqpvawtrysqkdqlylhiglkprvkehyrankvnlwlelvphlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ojkB (B:)
    etgqklddvdplvatnfgkirgikkelnneilgpviqflgvpyaapptgerrfqppepps
    pwsdirnatqfapvcpqniidgrlpevmlpvwftnnldvvssyvqdqsedclylniyvpt
    eddirdsggpkpvmvyihggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgd
    qaakgnyglldliqalrwtsenigffggdplritvfgsgaggscvnlltlshysegnrws
    nstkglfqraiaqsgtalsswavsfqpakyarmlatkvgcnvsdtvelveclqkkpykel
    vdqdiqparyhiafgpvidgdvipddpqilmeqgeflnydimlgvnqgeglkfvenivds
    ddgisasdfdfavsnfvdnlygypegkdvlretikfmytdwadrhnpetrrktllalftd
    hqwvapavatadlhsnfgsptyfyafyhhcqtdqvpawadaahgdevpyvlgipmigpte
    lfpcnfskndvmlsavvmtywtnfaktgdpnqpvpqdtkfihtkpnrfeevawtrysqkd
    qlylhiglkprvkehyrankvnlwlelvphlhnlndrtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ojkB (B:)
    dplvatnfgkirgikkelnneilgpviqflgvpyaapptgerrfqppeppspwsdirnat
    qfapvcpqniidrlpevmlpvwftnnldvvssyvqdqsedclylniyvptgpkpvmvyih
    ggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgdqaakgnyglldliqalrw
    tsenigffggdplritvfgsgaggscvnlltlshysegnrwsnstkglfqraiaqsgtal
    sswavsfqpakyarmlatkvgcnvsdtvelveclqkkpykelvdqdiqparyhiafgpvi
    dgdvipddpqilmeqgeflnydimlgvnqgeglkfvenivdsddgisasdfdfavsnfvd
    nlygypgkdvlretikfmytdwadrhnpetrrktllalftdhqwvapavatadlhsnfgs
    ptyfyafyhhcqtdqvpawadaahgdevpyvlgipmigptelfpcnfskndvmlsavvmt
    ywtnfaktgdpnqpvpvawtrysqkdqlylhiglkprvkehyrankvnlwlelvphl