PDB entry 5ohg

View 5ohg on RCSB PDB site
Description: enolase in complex with RNase E
Class: lyase
Keywords: enolase, RNase E, Lyase
Deposited on 2017-07-16, released 2017-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: eno, b2779, JW2750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ohga1, d5ohga2
  • Chain 'B':
    Compound: enolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: eno, b2779, JW2750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ohgb1, d5ohgb2
  • Chain 'C':
    Compound: Ribonuclease E
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rne, ams, hmp1, b1084, JW1071
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: enolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: eno, b2779, JW2750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ohgh1, d5ohgh2
  • Chain 'I':
    Compound: enolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: eno, b2779, JW2750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ohgi1, d5ohgi2
  • Chain 'J':
    Compound: Ribonuclease E
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rne, ams, hmp1, b1084, JW1071
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ohgA (A:)
    mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
    gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
    aaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvk
    eairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkd
    itlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdg
    fayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmak
    dagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgeka
    pyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ohgA (A:)
    mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
    gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
    aaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvk
    eairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkd
    itlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdg
    fayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmak
    dagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgeka
    pyngrkeikgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ohgB (B:)
    mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
    gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
    aaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvk
    eairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkd
    itlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdg
    fayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmak
    dagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgeka
    pyngrkeikgqa
    

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ohgH (H:)
    mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
    gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
    aaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvk
    eairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkd
    itlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdg
    fayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmak
    dagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgeka
    pyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ohgH (H:)
    mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
    gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
    aaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvk
    eairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkd
    itlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdg
    fayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmak
    dagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgeka
    pyngrkeikgq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5ohgI (I:)
    mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
    gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
    aaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvk
    eairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkd
    itlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdg
    fayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmak
    dagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgeka
    pyngrkeikgqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ohgI (I:)
    mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
    gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
    aaaaakgmplyehiaelngtpgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvk
    eairmgsevfhhlakvlkakgmntavgdeggyapnlgsnaealaviaeavkaagyelgkd
    itlamdcaasefykdgkyvlagegnkaftseefthfleeltkqypivsiedgldesdwdg
    fayqtkvlgdkiqlvgddlfvtntkilkegiekgiansilikfnqigsltetlaaikmak
    dagytavishrsgetedatiadlavgtaagqiktgsmsrsdrvakynqlirieealgeka
    pyngrkeikgq
    

  • Chain 'J':
    No sequence available.