PDB entry 5ogr

View 5ogr on RCSB PDB site
Description: Structure of cathepsin B1 from Schistosoma mansoni in complex with WRR286 inhibitor
Class: hydrolase
Keywords: protease, parasite, inhibitor, vinyl sulfone, HYDROLASE
Deposited on 2017-07-13, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin B-like peptidase (C01 family)
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: cb1.1, Smp_103610
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MNY2 (0-253)
      • engineered mutation (98)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d5ogra_
  • Chain 'B':
    Compound: Cathepsin B-like peptidase (C01 family)
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: cb1.1, Smp_103610
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MNY2 (0-253)
      • engineered mutation (98)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d5ogrb_
  • Chain 'C':
    Compound: Cathepsin B-like peptidase (C01 family)
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: cb1.1, Smp_103610
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MNY2 (0-253)
      • engineered mutation (98)
      • engineered mutation (213)
    Domains in SCOPe 2.07: d5ogrc_
  • Heterogens: VS4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ogrA (A:)
    veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd
    llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc
    gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye
    dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd
    ecsiesevtagrin
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ogrB (B:)
    veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd
    llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc
    gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye
    dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd
    ecsiesevtagrin
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ogrC (C:)
    veipssfdsrkkwprcksiatirdqsrcgscwafgaveamsdrsciqsggkqnvelsavd
    llsccescglgceggilgpawdywvkegivtgsskenhagcepypfpkcehhtkgkyppc
    gskiyktprckqtcqkkyktpytqdkhrgkssynvkndekaiqkeimkygpveagftvye
    dflnyksgiykhitgetlgghairiigwgvenkapywlianswnedwgengyfrivrgrd
    ecsiesevtagrin