PDB entry 5ogj

View 5ogj on RCSB PDB site
Description: Crystal structure of human carbonic anhydrase isozyme XIII with 2-(Cyclooctylamino)-3,5,6-trifluoro-4-[(2-hydroxyethyl)thio]benzenesulfonamide
Class: lyase
Keywords: drug design, carbonic anhydrase, benzenesulfonamide, metal-binding, lyase-lyase inhibitor complex, LYASE
Deposited on 2017-07-13, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ogja_
  • Chain 'B':
    Compound: Carbonic anhydrase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CA13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N1Q1 (1-262)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5ogjb_
  • Heterogens: ZN, CIT, PEG, ACT, EDO, V90, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ogjA (A:)
    mmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
    isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
    hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
    fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
    aflvsnhrppqplkgrkvrasfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ogjA (A:)
    lswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisns
    ghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvh
    wnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdll
    sllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflv
    snhrppqplkgrkvrasfh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ogjB (B:)
    mmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
    isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
    hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
    fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
    aflvsnhrppqplkgrkvrasfh