PDB entry 5og9

View 5og9 on RCSB PDB site
Description: The BM3 mutant WIFI-WC heme domain in complex with testosterone
Class: oxidoreductase
Keywords: cytochrome P450, testosterone, laboratory evolution, hydroxylation, steroids, OXIDOREDUCTASE
Deposited on 2017-07-12, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional cytochrome P450/NADPH--P450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2Q7T0
      • conflict (46)
      • conflict (50)
      • conflict (71)
      • conflict (81)
      • conflict (86)
      • conflict (180)
    Domains in SCOPe 2.07: d5og9a_
  • Chain 'B':
    Compound: Bifunctional cytochrome P450/NADPH--P450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2Q7T0
      • conflict (46)
      • conflict (50)
      • conflict (71)
      • conflict (81)
      • conflict (86)
      • conflict (180)
    Domains in SCOPe 2.07: d5og9b_
  • Heterogens: HEM, ZN, TES, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5og9A (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgwvtrwlssqrlike
    acdesrfdknliqalkfvrdffgdglitswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    cdeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkvrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5og9A (A:)
    kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgwvtrwlssqrlikeac
    desrfdknliqalkfvrdffgdglitswtheknwkkahnillpsfsqqamkgyhammvdi
    avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvracd
    eamnklqrnpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdp
    etgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
    sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
    ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
    edhtnyeldiketltlkpegfvvkakskkiplgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5og9B (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgwvtrwlssqrlike
    acdesrfdknliqalkfvrdffgdglitswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    cdeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkvrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5og9B (B:)
    kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgwvtrwlssqrlikeac
    desrfdknliqalkfvrdffgdglitswtheknwkkahnillpsfsqqamkgyhammvdi
    avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvracd
    eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
    petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
    psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
    dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
    fedhtnyeldiketltlkpegfvvkakskkiplg