PDB entry 5og2

View 5og2 on RCSB PDB site
Description: Cu nitrite reductase serial data at varying temperatures RT 0.09MGy
Class: oxidoreductase
Keywords: Electron transfer, nitrite reductase, OXIDOREDUCTASE
Deposited on 2017-07-11, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: nirK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5og2a1, d5og2a2
  • Heterogens: NO2, CU, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5og2A (A:)
    vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng
    svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka
    tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvp
    kdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhs
    qanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnh
    nlieafelgaaghfkvtgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5og2A (A:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvvkpas