PDB entry 5ofz

View 5ofz on RCSB PDB site
Description: PllA lectin, apo
Class: sugar binding protein
Keywords: PllA, apo, lectin, SUGAR BINDING PROTEIN
Deposited on 2017-07-11, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofza_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofzb_
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofzc_
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofzd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ofzA (A:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofzA (A:)
    dwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssia
    tlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysplk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ofzB (B:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofzB (B:)
    dwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssia
    tlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ofzC (C:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofzC (C:)
    dwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssia
    tlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysplk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ofzD (D:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofzD (D:)
    dwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssia
    tlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysplk