PDB entry 5ofx

View 5ofx on RCSB PDB site
Description: Plla lectin, trisaccharide complex
Class: sugar binding protein
Keywords: PllA, Complex, Lectin, carbohydrate, sugar binding protein
Deposited on 2017-07-11, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PllA
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofxa_
  • Chain 'B':
    Compound: PllA
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofxb_
  • Chain 'C':
    Compound: PllA
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofxc_
  • Chain 'D':
    Compound: PllA
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofxd_
  • Chain 'E':
    Compound: PllA
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofxe_
  • Chain 'F':
    Compound: PllA
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofxf_
  • Chain 'G':
    Compound: PllA
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofxg_
  • Chain 'H':
    Compound: PllA
    Species: Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofxh_
  • Heterogens: RAF, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ofxA (A:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofxA (A:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ofxB (B:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofxB (B:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ofxC (C:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofxC (C:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ofxD (D:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofxD (D:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ofxE (E:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofxE (E:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ofxF (F:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofxF (F:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ofxG (G:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofxG (G:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ofxH (H:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofxH (H:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k