PDB entry 5ofs

View 5ofs on RCSB PDB site
Description: X-ray structure of a zinc binding GB1 mutant
Class: metal binding protein
Keywords: immunoglobulin bindi, metal binding protein
Deposited on 2017-07-11, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • PDB 5OFS (0-55)
    Domains in SCOPe 2.07: d5ofsa_
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • PDB 5OFS (0-55)
    Domains in SCOPe 2.07: d5ofsb_
  • Chain 'C':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • PDB 5OFS (0-55)
    Domains in SCOPe 2.07: d5ofsc_
  • Chain 'D':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • PDB 5OFS (0-55)
    Domains in SCOPe 2.07: d5ofsd_
  • Heterogens: ZN, ACT, EDO, MPD, MRD, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ofsA (A:)
    mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ofsB (B:)
    mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ofsC (C:)
    mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ofsD (D:)
    mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte