PDB entry 5ofn

View 5ofn on RCSB PDB site
Description: Crystal structure of the heterotrimeric PriSLX primase from S. solfataricus.
Class: replication
Keywords: Primase, DNA-dependent RNA polymerase, DNA replication, REPLICATION
Deposited on 2017-07-11, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase small subunit PriS
    Species: Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) [TaxId:273057]
    Gene: priS, priA, SSO1048
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofna_
  • Chain 'B':
    Compound: DNA primase large subunit PriL,PriL-X fusion protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: priL, priB, SSO0557, C21_042
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UWW1 (Start-44)
    • PDB 5OFN (41-153)
    Domains in SCOPe 2.07: d5ofnb_
  • Chain 'C':
    Compound: DNA primase large subunit PriL,PriL-X fusion protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: priL, priB, SSO0557, C21_042
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UWW1
    • PDB 5OFN (Start-323)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ofnA (A:)
    mgtftlhqgqtnliksffrnyylnaelelpkdmelrefalqpfgsdtyvrhlsfssseel
    rdylvnrnlplhlfyssaryqlpsarnmeekawmgsdllfdidadhlcklrsirfcpvcg
    navvsekcerdnvetleyvemtsecikrgleqtrnlveileddfglkpkvyfsgnrgfhv
    qvdcygncalldsderkeiaeyvmgigvpgypggsenapgwvgrknrgingvtideqvti
    dvkrliripnslhgksglivkrvpnlddfefnetlspftgytiflpyitietevlgsiik
    lnrgipikikssigiylhlrnlgevkayvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofnA (A:)
    tnliksffrnyylnaelelpkdmelrefalqpfgsdtyvrhlsfssseelrdylvnrnlp
    lhlfyssaryqlpsarnmeekawmgsdllfdidadhlcklrsirfcpvcgnavvsekcer
    dnvetleyvemtsecikrgleqtrnlveileddfglkpkvyfsgnrgfhvqvdcygncal
    ldsderkeiaeyvmgigvpgypggsenapgwvgrknrgingvtideqvtidvkrliripn
    slhgksglivkrvpnlddfefnetlspftgytiflpyitietevlgsiiklnrgipikik
    ssigiylhlrnlgevkayv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ofnB (B:)
    maldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsy
    nepvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrc
    dpikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqliglia
    esikskivemirplnlkeipeklkslierrgkvegkfppqpkkssdyswiekvlemglqd
    srkrfilyvasrylvnvkgvnedealqtlkefyyklqsgkvyeswlksvingvkkkgllp
    wslkrieerdkemyneiirvlkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofnB (B:)
    ldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsyne
    pvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrcdp
    ikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqligliaes
    ikskivemirplnlkeipeklkslie
    

  • Chain 'C':
    No sequence available.