PDB entry 5ofi

View 5ofi on RCSB PDB site
Description: PllA lectin, Fluorophore carbohydrate complex
Class: sugar binding protein
Keywords: PIIA, Complex, Lectin, SUGAR BINDING PROTEIN
Deposited on 2017-07-11, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: piia
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofia_
  • Chain 'B':
    Compound: piia
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofib_
  • Chain 'C':
    Compound: piia
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofic_
  • Chain 'D':
    Compound: piia
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofid_
  • Chain 'E':
    Compound: piia
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofie_
  • Chain 'F':
    Compound: piia
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofif_
  • Chain 'G':
    Compound: piia
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofig_
  • Chain 'H':
    Compound: piia
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofih_
  • Heterogens: CA, 9TQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ofiA (A:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofiA (A:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ofiB (B:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofiB (B:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ofiC (C:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofiC (C:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ofiD (D:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofiD (D:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ofiE (E:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofiE (E:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ofiF (F:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofiF (F:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ofiG (G:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofiG (G:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ofiH (H:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ofiH (H:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k