PDB entry 5ofc

View 5ofc on RCSB PDB site
Description: Cu nitrite reductase serial data at varying temperatures 190K 21.65MGy
Class: oxidoreductase
Keywords: Electron transfer, nitrite reductase, OXIDOREDUCTASE
Deposited on 2017-07-10, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: nirK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ofca1, d5ofca2
  • Heterogens: CU, NO2, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ofcA (A:)
    vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng
    svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka
    tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvp
    kdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhs
    qanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnh
    nlieafelgaaghfkvtgewnddlmtsvvkpasm