PDB entry 5oeh

View 5oeh on RCSB PDB site
Description: Molecular tweezers modulate 14-3-3 protein-protein interactions.
Class: signaling protein
Keywords: 14-3-3 Protein, Inhibition, supramolecular ligands, SIGNALING PROTEIN
Deposited on 2017-07-07, released 2017-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d5oeha1, d5oeha2
  • Heterogens: 9SZ, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oehA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oehA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksnkgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfyl
    kmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhy
    eianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt