PDB entry 5oeg

View 5oeg on RCSB PDB site
Description: Molecular tweezers modulate 14-3-3 protein-protein interactions
Class: signaling protein
Keywords: 14-3-3, Inhibition, Supramolecular ligand, SIGNALING PROTEIN
Deposited on 2017-07-07, released 2017-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (4-234)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5oega1, d5oega2
  • Heterogens: 9SZ, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oegA (A:)
    amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
    aawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaes
    rvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnf
    svfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oegA (A:)
    amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
    aawrvlssieqksngpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkm
    kgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyei
    anspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt