PDB entry 5oed

View 5oed on RCSB PDB site
Description: Human Rab32:GDP in complex with Salmonella GtgE C45A mutant
Class: hydrolase
Keywords: Rab GTPase, Posttranslational Modification, Proteolysis, Salmonella Infection, HYDROLASE
Deposited on 2017-07-07, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GtgE
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: gtgE, IN36_21720, IN69_16745, IN77_18825
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6EAT3
      • engineered mutation (46)
  • Chain 'B':
    Compound: ras-related protein rab-32
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB32
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oedb_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oedB (B:)
    metrehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlq
    lwdiagqerfgnmtrvyykeavgafvvfdisrsstfeavlkwksdldskvhlpngspipa
    vllankcdqnkdssqspsqvdqfckehgfagwfetsakdninieeaarflvekilvnhqs
    fpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oedB (B:)
    trehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlqlw
    diagqerfgnmtrvyykeavgafvvfdisrsstfeavlkwksdldskvhlpngspipavl
    lankcsqvdqfckehgfagwfetsakdninieeaarflvekilvn