PDB entry 5odz

View 5odz on RCSB PDB site
Description: crystal structure of the beta-lactamase oxa-163
Class: antibiotic
Keywords: antibiotic resistance, oxacillinase, OXA-48-like, cephalosporinase, ANTIBIOTIC
Deposited on 2017-07-07, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5odzb_
  • Chain 'D':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5odzd_
  • Heterogens: CL, MG, PGE, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5odzB (B:)
    hhhhhhenlyfqgkewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpa
    stfkipnslialdlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarq
    igearmskmlhafdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqr
    ivkqamlteangdyiiraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqai
    tkevlkqekiip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5odzB (B:)
    kewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsliald
    lgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhaf
    dygnedisgnvdsfwldggirisateqiflrklyhnklhvsersqrivkqamlteangdy
    iiraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5odzD (D:)
    hhhhhhenlyfqgkewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpa
    stfkipnslialdlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarq
    igearmskmlhafdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqr
    ivkqamlteangdyiiraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqai
    tkevlkqekiip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5odzD (D:)
    kewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsliald
    lgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhaf
    dygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangd
    yiiraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip