PDB entry 5odu

View 5odu on RCSB PDB site
Description: PllA lectin, monosaccharide complex
Class: sugar binding protein
Keywords: PllA, Complex, Lectin, CARBOHYDRATE, sugar binding protein
Deposited on 2017-07-06, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PllA
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5odua_
  • Chain 'B':
    Compound: PllA
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5odub_
  • Chain 'C':
    Compound: PllA
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oduc_
  • Chain 'D':
    Compound: PllA
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5odud_
  • Chain 'E':
    Compound: PllA
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5odue_
  • Chain 'F':
    Compound: PllA
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oduf_
  • Chain 'G':
    Compound: PllA
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5odug_
  • Chain 'H':
    Compound: PllA
    Species: Photorhabdus luminescens [TaxId:29488]
    Gene: plu2096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oduh_
  • Heterogens: AMG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oduA (A:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oduA (A:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oduB (B:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oduB (B:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5oduC (C:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oduC (C:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5oduD (D:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oduD (D:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5oduE (E:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oduE (E:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5oduF (F:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oduF (F:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5oduG (G:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oduG (G:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5oduH (H:)
    msdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpss
    iatlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesrysp
    lk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oduH (H:)
    sdwsgsvpanaengkstglilkqgdtisvvahgwvkygrdnvewaapdgpvpnnpqpssi
    atlvakiankkfaigngvlhktvpvdgelillfndvpgtfgdnsgefqveviiesryspl
    k