PDB entry 5ocn

View 5ocn on RCSB PDB site
Description: Crystal structure of the forkhead domain of human FOXN1
Class: transcription
Keywords: Forkhead domain, thymus, transcription factor, Transcription
Deposited on 2017-07-03, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ocna_
  • Chain 'B':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ocnb_
  • Chain 'C':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ocnc_
  • Chain 'D':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ocnd_
  • Chain 'E':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ocne_
  • Chain 'F':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ocnf_
  • Chain 'G':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ocng_
  • Chain 'H':
    Compound: Forkhead box protein N1
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXN1, RONU, WHN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ocnh_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ocnA (A:)
    smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
    cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocnA (A:)
    pkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcf
    ekvegclwalnpakidkmqeelqkwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ocnB (B:)
    smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
    cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocnB (B:)
    pkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcf
    ekvekgclwalnpakidkmqeelqkwk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ocnC (C:)
    smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
    cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocnC (C:)
    piysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfek
    veclwalnpakidkmqeelqkwk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ocnD (D:)
    smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
    cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocnD (D:)
    ysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekve
    kgclwalnpakidkmqeelqkw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ocnE (E:)
    smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
    cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocnE (E:)
    piysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfek
    vegclwalnpakidkmqeelqk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ocnF (F:)
    smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
    cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocnF (F:)
    pkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcf
    ekvegclwalnpakidkmqeelqk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ocnG (G:)
    smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
    cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocnG (G:)
    sysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekveg
    clwalnpakidkmqeelqkw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ocnH (H:)
    smpkpiysysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnk
    cfekvenksgsssrkgclwalnpakidkmqeelqkwkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocnH (H:)
    sysilifmalknsktgslpvseiynfmtehfpyfktapdgwknsvrhnlslnkcfekveg
    clwalnpakidkmqeelqkw