PDB entry 5oca

View 5oca on RCSB PDB site
Description: PCSK9:Fab Complex with Dextran Sulfate
Class: hydrolase
Keywords: hydrolase, protein fab complex, autocatalytic cleavage, cholesterol metabolism, disease mutation, disulfide bond, glycoprotein, lipid metabolism, phosphoprotein, protease, secreted, serine protease, steroid metabolism, zymogen, hydrolase-immune system complex
Deposited on 2017-06-30, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBP7 (0-End)
      • conflict (321)
      • conflict (380)
      • conflict (467)
  • Chain 'H':
    Compound: Fab from LDLR competitive antibody: Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCA (0-End)
  • Chain 'L':
    Compound: Fab from LDLR competitive antibody: Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OCA (0-End)
    Domains in SCOPe 2.07: d5ocal1, d5ocal2
  • Heterogens: 9QZ, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ocaL (L:)
    esvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapkllisgnsnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ocaL (L:)
    esvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapkllisgnsnrpsgv
    pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt